PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00009681-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 662aa    MW: 72133.1 Da    PI: 5.5899
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00009681-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-094154521954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +e+  LA+++gLt +qV++WF N R +
  SMil_00009681-RA_Salv 415 FEHflHPYPKDSEKIMLARQTGLTRSQVSNWFINARVR 452
                            554459******************************88 PP

2BELL126.41.1e-40277348172
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            e+qelq+k +kLl++l+eVd+rY+qy++q+q+v+ssF+++ag g+akpYt+lAl++iSrhFrcL+dai +qi
  SMil_00009681-RA_Salv 277 EKQELQNKLTKLLTMLDEVDRRYRQYYHQMQIVVSSFDVIAGSGAAKPYTALALQTISRHFRCLRDAINGQI 348
                            689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.8E-58203346IPR006563POX domain
PfamPF075264.2E-50209344IPR006563POX domain
PROSITE profilePS5007112.357393456IPR001356Homeobox domain
SMARTSM003893.6E-10396460IPR001356Homeobox domain
CDDcd000862.81E-13396457No hitNo description
SuperFamilySSF466891.41E-17397463IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-29399462IPR009057Homeodomain-like
PfamPF059207.7E-18413452IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MGTYFPVSNN QRDASTMLYL KDPAPTSHSS TPILTGNTIM YMNFPPPSSE PFSDAIAGNS  60
HSHTTCMDAP PAASNSNTSP QEVLLNFGGS RALESQLNTW KDGRNEMLMM HQAQAGGSSF  120
QAGPSLQGQG LSLSLSTHVP LHVSTMPYQN EGADFSSILG SNALMHGEDR GRNISFENED  180
SFAAGVPGAN VDGASDMSSY GMPSIARAVP NSKYLRAAQE LLDEVVNVKK AIKEQSARKE  240
PRREVEGELK DGGSDPSFSA TPKGNGASSH VEVSAAEKQE LQNKLTKLLT MLDEVDRRYR  300
QYYHQMQIVV SSFDVIAGSG AAKPYTALAL QTISRHFRCL RDAINGQIQV ARRSLGEEDA  360
SSNERGIGIS RLRYVDQQLR QQRALQQLGM MQQHAWRPQR GLPESSVSVL RAWLFEHFLH  420
PYPKDSEKIM LARQTGLTRS QVSNWFINAR VRLWKPMVEE MYKEETGDAD VDSNSSSETN  480
PRAPKPGAKA SEDRAEDLQQ QQHGTVSVGQ QLMEPKCDEM NDVEMMGSDA NSIFQSEYGG  540
GKTTGVDKAD HEPGHFQDAV AESSCGSERF MAAAAAGYHM SELERFGSIS GGVSLTLGLQ  600
QCEGGGRMAM PNSNHNAFIP LRETDVYNTA ASAMGGDPAD FECLDSGSRQ HRLVSSLLPS  660
FT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A6e-17402459158Homeobox protein Meis1
4xrs_B6e-17402459158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088451.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A067E6F10.0A0A067E6F1_CITSI; Uncharacterized protein
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA102052226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-123BEL1-like homeodomain 6